Proteintech, 80009-1-RR, Collagen Type III (N-terminal) Recombinant monoclonal antibody

Size: 20ul / 100ul The Collagen Type III (N-terminal) (80009-1-RR) by Proteintech is a Recombinant antibody targeting Collagen Type III (N-terminal) in IHC, IF-P, ELISA applications with reactivity to human samples 80009-1-RR targets Collagen Type III (N-terminal) in IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human colon tissue, human colon cancer tissue, human ovary tumor tissue, human pancreas cancer tissue, human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human colon tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Type III collagen is a fibrillar forming collagen comprising three α1(III) chains and is expressed in early embryos and throughout embryogenesis (PMID: 9050868). In the adult, type III collagen is a major component of the extracellular matrix in a variety of internal organs and skin. It occurs in most soft connective tissues along with type I collagen (PMID: 2445760). COL3A1 gene encodes type III procollagen. Mutations in this gene are associated with Ehlers-Danlos syndrome types IV, and with aortic and arterial aneurysms (PMID: 10706896; 2243125; 18389341). This antibody was raised against 24-152 aa of prepro α1 (III) chain of human type III procollagen. It can't recognize mouse or rat type III collagen. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag18658 Product name: Recombinant human COL3A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-152 aa of BC028178 Sequence: QQEAVEGGCSHLGQSYADRDVWKPEPCQICVCDSGSVLCDDIICDDQELDCPNPEIPFGECCAVCPQPPTAPTRPPNGQGPQGPKGDPGPPGIPGRNGDPGIPGQPGSPGSPGPPGICESCPTGPQNYS Predict reactive species Full Name: collagen, type III, alpha 1 Calculated Molecular Weight: 1466 aa, 139 kDa GenBank Accession Number: BC028178 Gene Symbol: COL3A1 Gene ID (NCBI): 1281 RRID: AB_2882939 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P02461 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.