Iright
BRAND / VENDOR: Proteintech

Proteintech, 80209-5-RR, AMPK Alpha Recombinant monoclonal antibody

CATALOG NUMBER: 80209-5-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The AMPK Alpha (80209-5-RR) by Proteintech is a Recombinant antibody targeting AMPK Alpha in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples 80209-5-RR targets AMPK Alpha in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells Positive IF-P detected in: rat brain tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information The mammalian 5-prime-AMP-activated protein kinase (AMPK) appears to play a role in protecting cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways. PRKAA1 is also named as AMPK1, ACACA kinase, HMGCR kinase. It is a mammalian homologue of sucrose non-fermenting protein kinase (SNF-1), which belongs to a serine/threonine protein kinase family. It has 2 isoforms with molecular mass of 63-66 kDa produced by alternative splicing. 80209-5-RR can recognize both AMPK Alpha 1 and AMPK Alpha 2. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1367 Product name: Recombinant human AMPK alpha protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-207 aa of BC012622 Sequence: MATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRDCNIIRILTSQFTNYQH Predict reactive species Full Name: protein kinase, AMP-activated, alpha 1 catalytic subunit Calculated Molecular Weight: 63 kDa Observed Molecular Weight: 64 kDa GenBank Accession Number: BC012622 Gene Symbol: AMPK Alpha 1 Gene ID (NCBI): 5562 RRID: AB_3670471 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q13131 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924