Proteintech, 80793-1-RR, Fetuin-A/AHSG Recombinant monoclonal antibody

Size: 20ul / 100ul The Fetuin-A/AHSG (80793-1-RR) by Proteintech is a Recombinant antibody targeting Fetuin-A/AHSG in WB, ELISA applications with reactivity to human samples 80793-1-RR targets Fetuin-A/AHSG in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma, human heart tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information Fetuin-A, also named as Alpha2-HS glycoprotein (AHSG), is a member of cystatin superfamily of protease inhibitors. It is a highly expressed glycoprotein in various fetal tissues whereas it is mainly expressed by the liver in adults. Fetuin A, an extracellular inhibitor of transforming growth factor β, is a profibrogenic stimulus in liver disease. Circulating fetuin-A may be a beneficial serum biomarker in the detection of liver and vascular fibrosis progression in patients with non-alcoholic fatty liver disease. It is also involved in several functions, such as endocytosis, brain development and the formation of bone tissue. Fetuin-A exerts its effects on the cardiovascular system by two different mechanisms. On the one hand it inhibits ins signaling and induces ins resistance contributing to the onset of atherosclerosis and on the other hand it inhibits calcium deposition and protects from vascular calcification. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag9853 Product name: Recombinant human AHSG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-367 aa of BC048198 Sequence: MKSLVLLLCLAQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKV Predict reactive species Full Name: alpha-2-HS-glycoprotein Calculated Molecular Weight: 367 aa, 39 kDa Observed Molecular Weight: 58 kDa GenBank Accession Number: BC048198 Gene Symbol: Fetuin-A Gene ID (NCBI): 197 RRID: AB_2918913 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P02765 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.