Proteintech, 80964-5-RR, SMAD7 Recombinant monoclonal antibody

Size: 20ul / 100ul The SMAD7 (80964-5-RR) by Proteintech is a Recombinant antibody targeting SMAD7 in WB, ELISA applications with reactivity to human, mouse, rat samples 80964-5-RR targets SMAD7 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SH-SY5Y cells, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information SMAD7, also named as Mothers against decapentaplegic homolog 7, is a 426 amino acid protein, which belongs to the dwarfin/SMAD family. SMAD7 Interaction with NEDD4L or RNF111 induces translocation from the nucleus to the cytoplasm (PubMed:16601693). TGF-beta stimulates its translocation from the nucleus to the cytoplasm. PDPK1 inhibits its translocation from the nucleus to the cytoplasm in response to TGF-beta (PubMed:17327236). SMAD7 as antagonist of signaling by TGF-beta type 1 receptor superfamily members has been shown to inhibit TGF-beta and activin signaling by associating with their receptors thus preventing SMAD2 access. SMAD7 functions as an adapter to recruit SMURF2 to the TGF-beta receptor complex and also acts by recruiting the PPP1R15A-PP1 complex to TGFBR1, which promotes its dephosphorylation. SMAD7 positively regulates PDPK1 kinase activity by stimulating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regulator. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag13688 Product name: Recombinant human SMAD7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-426 aa of BC074819 Sequence: MFRTKRSALVRRLWRSRAPGGEDEEEGAGGGGGGGELRGEGATDSRAHGAGGGGPGRAGCCLGKAVRGAKGHHHPHPPAAGAGAAGGAEADLKALTHSVLKKLKERQLELLLQAVESRGGTRTACLLLPGRLDCRLGPGAPAGAQPAQPPSSYSLPLLLCKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNGFCLGQLNSDNKSQLVQKVRSKIGCGIQLTREVDGVWVYNRSSYPIFIKSATLDNPDSRTLLVHKVFPGFSIKAFDYEKAYSLQRPNDHEFMQQPWTGFTVQISFVKGWGQCYTRQFISSCPCWLEVIFNSR Predict reactive species Full Name: SMAD family member 7 Calculated Molecular Weight: 426 aa, 46 kDa Observed Molecular Weight: 58 kDa GenBank Accession Number: BC074819 Gene Symbol: SMAD7 Gene ID (NCBI): 4092 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O15105 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.