Proteintech, 81161-3-RR, ZAK Recombinant monoclonal antibody

Size: 20ul / 100ul The ZAK (81161-3-RR) by Proteintech is a Recombinant antibody targeting ZAK in IHC, IF/ICC, ELISA applications with reactivity to human samples 81161-3-RR targets ZAK in IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information ZAK(sterile-alpha motif and leucine zipper containing kinase AZK) is also named as MLTK, MAPKKK, mlklak, MLK7, AZK, MLT, MRK, HCCS-4, MAP3K20 and belongs to the MAPKKK family. It is a mitogen-activated protein kinase kinase kinase (MAP3K) that activates the stress-activated protein kinase/c-jun N-terminal kinase pathway and activates NF-kappaB. ZAK contributes to regulation of DNA damage checkpoints through a p38 gamma-independent pathway. This protein has 3 isoforms produced by alternative splicing with the MW of 91 kDa (ZAK alpha), 51 kDa (ZAK beta) and 35 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag30599 Product name: Recombinant human ZAK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 223-325 aa of BC001401 Sequence: ERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNKAEWRCEIEATLERLKKLERDLSFKEQELKERERRLKMWEQKLTEQ Predict reactive species Full Name: sterile alpha motif and leucine zipper containing kinase AZK Calculated Molecular Weight: 91 kDa GenBank Accession Number: BC001401 Gene Symbol: ZAK Gene ID (NCBI): 51776 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NYL2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.