Proteintech, 81373-8-RR, CDKN2A/P16-INK4A Recombinant monoclonal antibody

Size: 20ul / 100ul The CDKN2A/P16-INK4A (81373-8-RR) by Proteintech is a Recombinant antibody targeting CDKN2A/P16-INK4A in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 81373-8-RR targets CDKN2A/P16-INK4A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, TF-1 cells, SiHa cells Positive IHC detected in: human cervical cancer tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CDKN2A generates several transcript variants which differ in their first exons. At least three alternatively-spliced variants encoding distinct proteins proteins were reported. Two of them named p16-INK4 and p14 are sharing 50% identity. P16 plays an essential role in regulating the cell cycle, and mutations in p16 increase the risk of developing various cancers, including melanoma. Long-term p16(INK4a) expression pushes cells to enter senescence, an irreversible cell-cycle arrest that precludes the growth of would-be cancer cells but also contributes to cellular aging (PMID: 24136988). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1328 Product name: Recombinant human P16-INK4A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 52-156 aa of BC021998 Sequence: MMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD Predict reactive species Full Name: cyclin-dependent kinase inhibitor 2A Calculated Molecular Weight: 16 kDa Observed Molecular Weight: 16 kDa GenBank Accession Number: BC021998 Gene Symbol: CDKN2A Gene ID (NCBI): 1029 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P42771 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.