Iright
BRAND / VENDOR: Proteintech

Proteintech, 81479-1-RR, PSAT1 Recombinant monoclonal antibody

CATALOG NUMBER: 81479-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The PSAT1 (81479-1-RR) by Proteintech is a Recombinant antibody targeting PSAT1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, pig samples 81479-1-RR targets PSAT1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, pig samples. Tested Applications Positive WB detected in: HepG2 cells, K-562 cells, NIH/3T3 cells, pig brain tissue Positive IHC detected in: human ovarian cancerNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information PSAT1, also named as PSA and PSAT, belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family and SerC subfamily. It catalyzes the reversible conversion of 3-phosphohydroxypyruvate to phosphoserine and of 3-hydroxy-2-oxo-4-phosphonooxybutanoate to phosphohydroxythreonine. PSAT1 represents a new interesting target for CRC therapy. It may be implicated in altered serine metabolism and schizophrenia spectrum conditions. (PMID: 18221502, 20955740) Specification Tested Reactivity: human, mouse, pig Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0776 Product name: Recombinant human PSAT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-370 aa of BC004863 Sequence: MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLEMHQL Predict reactive species Full Name: phosphoserine aminotransferase 1 Calculated Molecular Weight: 40 kDa Observed Molecular Weight: 37-40 kDa GenBank Accession Number: BC004863 Gene Symbol: PSAT1 Gene ID (NCBI): 29968 RRID: AB_2935554 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Y617 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924