Iright
BRAND / VENDOR: Proteintech

Proteintech, 81632-1-RR, GPR126 Recombinant monoclonal antibody

CATALOG NUMBER: 81632-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The GPR126 (81632-1-RR) by Proteintech is a Recombinant antibody targeting GPR126 in IHC, ELISA applications with reactivity to Human, mouse samples 81632-1-RR targets GPR126 in IHC, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GPR126 (G protein-coupled receptor 126) is a member of the adhesion GPCR family. GPR126 is all widely expressed on stromal cells (PMID: 25713288). It is essential for normal differentiation of promyelinating Schwann cells and for normal myelination of axons (PMID: 24227709). GPR126 regulates neural, cardiac and ear development by G-protein- and/or N-terminus-dependent signaling (PMID: 24082093, PMID: 24067352). GPR126 also stimulates VEGF signaling and angiogenesis by modulating VEGF receptor 2 expression through STAT5 and GATA2 in endothelial cells. Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag12195 Product name: Recombinant human GPR126 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 45-399 aa of BC075798 Sequence: LSNPSGTFTSPCYPNDYPNSQACMWTLRAPTGYIIQITFNDFDIEEAPNCIYDSLSLDNGESQTKFCGATAKGLSFNSSANEMHVSFSSDFSIQKKGFNASYIRVAVSLRNQKVILPQTSDAYQVSVAKSISIPELSAFTLCFEATKVGHEDSDWTAFSYSNASFTQLLSFGKAKSGYFLSISDSQCLLNNALPVKEKEDIFAESFEQLCLVWNNSLGSIGVNFKRNYETVPCDSTISKVIPGNGKLLLGSNQNEIVSLKGDIYNFRLWNFTMNAKILSNLSCNVKGNVVDWQNDFWNIPNLALKAESNLSCGSYLIPLPAAELASCADLGTLCQDGIIYRISVVIQNILRHPEV Predict reactive species Full Name: G protein-coupled receptor 126 Calculated Molecular Weight: 1222 aa, 137 kDa GenBank Accession Number: BC075798 Gene Symbol: GPR126 Gene ID (NCBI): 57211 RRID: AB_2935569 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q86SQ4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924