Iright
BRAND / VENDOR: Proteintech

Proteintech, 81837-1-RR, RAB1A Recombinant monoclonal antibody

CATALOG NUMBER: 81837-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The RAB1A (81837-1-RR) by Proteintech is a Recombinant antibody targeting RAB1A in WB, ELISA applications with reactivity to Human, mouse, rat samples 81837-1-RR targets RAB1A in WB, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2264 Product name: Recombinant human RAB1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-205 aa of BC000905 Sequence: MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC Predict reactive species Full Name: RAB1A, member RAS oncogene family Calculated Molecular Weight: 205 aa, 23 kDa Observed Molecular Weight: 23-25 kDa GenBank Accession Number: BC000905 Gene Symbol: RAB1A Gene ID (NCBI): 5861 RRID: AB_3086459 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P62820 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924