Proteintech, 81976-3-RR, BIM/BCL2L11 Recombinant monoclonal antibody

Size: 20ul / 100ul The BIM/BCL2L11 (81976-3-RR) by Proteintech is a Recombinant antibody targeting BIM/BCL2L11 in WB, ELISA applications with reactivity to human, mouse samples 81976-3-RR targets BIM/BCL2L11 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: PC-12 cells, A20 cells, mouse thymus tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information BIM (BCL2L11) is a central BH3-only apoptosis activator that antagonizes anti-apoptotic BCL-2 proteins and directly triggers BAX/BAK-mediated mitochondrial permeabilization. Induced by cellular stress and cytokine withdrawal, BIM governs developmental cell death, immune tolerance, and tumor suppression. Alterations in BIM expression or splicing-particularly the deletion polymorphism affecting its BH3-only activity-underlie cancer therapy resistance, autoimmune disorders, and neuronal apoptosis. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag11875 Product name: Recombinant human BIM, BCL2L11 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-198 aa of BC033694 Sequence: MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH Predict reactive species Full Name: BCL2-like 11 (apoptosis facilitator) Calculated Molecular Weight: 198 aa, 22 kDa Observed Molecular Weight: 16 kDa, 23 kDa GenBank Accession Number: BC033694 Gene Symbol: Bim Gene ID (NCBI): 10018 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O43521 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.