Proteintech, 82512-1-RR, EIF3D Recombinant monoclonal antibody

Size: 20ul / 100ul The EIF3D (82512-1-RR) by Proteintech is a Recombinant antibody targeting EIF3D in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, rat samples 82512-1-RR targets EIF3D in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HeLa cells, rat liver tissue, HEK-293 cells, HepG2 cells, A549 cells, A431 cells, Jurkat cells Positive IP detected in: A549 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information The mammalian translation initiation factor 3 (eIF3), is a multiprotein complex of ~600 kDa that binds to the 40 S ribosome and promotes the binding of methionyl-tRNAi and mRNA. The EIF3S7(p66) is the major RNA binding subunit in this complex. Human eIF3-p66 shares 64% sequence identity with a hypothetical Caenorhabditis elegans protein, presumably the p66 homolog. Deletion analyses of recombinant derivatives of eIF3-p66 show that the RNA-binding domain lies within an N-terminal 71-amino acid region rich in lysine and arginine. Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0268 Product name: Recombinant human EIF3D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 323-531 aa of BC000328 Sequence: FSQQCLRMGKERYNFPNPNPFVEDDMDKNEIASVAYRYRRWKLGDDIDLIVRCEHDGVMTGANGEVSFINIKTLNEWDSRHCNGVDWRQKLDSQRGAVIATELKNNSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVIRVYSLPDGTFSSDE Predict reactive species Full Name: eukaryotic translation initiation factor 3, subunit D Calculated Molecular Weight: 66 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC000328 Gene Symbol: EIF3D Gene ID (NCBI): 8664 RRID: AB_3086486 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O15371 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.