Iright
BRAND / VENDOR: Proteintech

Proteintech, 82559-1-RR, Stathmin 1 Recombinant monoclonal antibody

CATALOG NUMBER: 82559-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The Stathmin 1 (82559-1-RR) by Proteintech is a Recombinant antibody targeting Stathmin 1 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 82559-1-RR targets Stathmin 1 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SH-SY5Y cells, HepG2 cells, Jurkat cells, PC-12 cells Positive IHC detected in: rat brain tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Positive IF/ICC detected in: HeLa cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information Stathmin 1 (STMN1) normally regulates microtubule dynamics either by sequestering free tubulin heterodimers or by promoting microtubule catastrophe. STMN1 is highly expressed in fetal and adult brain, spinal cord, and cerebellum. Many different phosphorylated forms are observed depending on specific combinations among the sites which can be phosphorylated. Phosphorylation of stathmin is involved in response to NGF, neuron polarization and microtubule polymerization inhibition activity. Increased expression of STMN1 has been observed in a variety of human malignancies, such as colorectal primary tumors and metastatic tissues, but its association with melanoma is so far not well known. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1633 Product name: Recombinant human STMN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-149 aa of BC014353 Sequence: MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDFSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD Predict reactive species Full Name: stathmin 1/oncoprotein 18 Calculated Molecular Weight: 18 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: BC014353 Gene Symbol: Stathmin 1 Gene ID (NCBI): 3925 RRID: AB_3086489 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P16949 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924