Proteintech, 82696-17-RR, IL-1 beta Recombinant monoclonal antibody

Size: 20ul / 100ul The IL-1 beta (82696-17-RR) by Proteintech is a Recombinant antibody targeting IL-1 beta in WB, ELISA applications with reactivity to human samples 82696-17-RR targets IL-1 beta in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, LPS and Brefeldin A treated THP-1 cells, HT-1080 cells, U-87 MG cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information Interleukin-1, produced mainly by blood monocytes, mediates the panoply of host reactions collectively known as acute phase response. It is identical to endogenous pyrogen. The multiple biologic activities that define IL1 are properties of a 15- to 18-kD protein that is derived from a 30- to 35-kD precursor. Interleukin 1β (IL-1B) is a member of the interleukin 1 cytokine family. It is a pro-inflammatory cytokine against infection, playing an important role in the pathogenesis of cancers. It signals through various adaptor proteins and kinases that lead to the activation of numerous downstream targets. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0286 Product name: Recombinant Human IL-1 Beta protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: N-6*HIS Domain: 117-269 aa of BC008678 Sequence: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS Predict reactive species Full Name: interleukin 1, beta Calculated Molecular Weight: 269 aa, 31 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC008678 Gene Symbol: IL1B Gene ID (NCBI): 3553 ENSEMBL Gene ID: ENSG00000125538 RRID: AB_3670530 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P01584 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.