Iright
BRAND / VENDOR: Proteintech

Proteintech, 82720-14-RR, CAMKK2 Recombinant monoclonal antibody

CATALOG NUMBER: 82720-14-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The CAMKK2 (82720-14-RR) by Proteintech is a Recombinant antibody targeting CAMKK2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 82720-14-RR targets CAMKK2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, PC-3 cells, LNCaP cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-3 cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information CAMKK2(calcium/calmodulin-dependent protein kinase kinase 2) is also named as CAMKKB, KIAA0787 and belongs to the protein kinase superfamily. It regulates hypothalamic production of the orexigenic hormone NPY and contributes to the regulation of energy balance. CAMKK2 in vivo reduces tumor growth suggests that reactivation of CAMKK2 by development of new drugs may be a new strategy to prolong the period to respond androgen-deprivation therapy(ADT)(PMID:22549914). It can be autophosphorylated(PMID:19369195). It has 7 isoforms produced by alternative splicing. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2093 Product name: Recombinant human CAMKK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-353 aa of BC026060 Sequence: MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDSSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGMQDCVQLNQYTLKDEIGKGSYGVVKLAYNENDNTYYAMKVLSKKKLIRQAGFPRRPPPRGTRPAPGGCIQPRGPIEQVYQEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAF Predict reactive species Full Name: calcium/calmodulin-dependent protein kinase kinase 2, beta Calculated Molecular Weight: 588 aa, 60 kDa Observed Molecular Weight: 60-70 kDa GenBank Accession Number: BC026060 Gene Symbol: CAMKK2 Gene ID (NCBI): 10645 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96RR4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924