Iright
BRAND / VENDOR: Proteintech

Proteintech, 82747-2-RR, CD79a Recombinant monoclonal antibody

CATALOG NUMBER: 82747-2-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The CD79a (82747-2-RR) by Proteintech is a Recombinant antibody targeting CD79a in IF/ICC, IF-P, ELISA applications with reactivity to human samples 82747-2-RR targets CD79a in IF/ICC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive IF-P detected in: mouse spleen tissue Positive IF/ICC detected in: Raji cells Recommended dilution Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Background Information CD79a, also named as B-cell antigen receptor complex-associated protein alpha chain or MB-1 membrane glycoprotein, is a 226 amino acid protein, which contains one ITAM domain and one Ig-like C2-type (immunoglobulin-like) domain. CD79A is expressed in B cells and localizes in the cell membrane. CD79A is required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. CD79A is also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag17924 Product name: Recombinant human CD79A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 33-144 aa of BC113733 Sequence: LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRI Predict reactive species Full Name: CD79a molecule, immunoglobulin-associated alpha Calculated Molecular Weight: 226 aa, 25 kDa GenBank Accession Number: BC113733 Gene Symbol: CD79A Gene ID (NCBI): 973 RRID: AB_3670544 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P11912 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924