Product Description
Size: 20ul / 100ul
The CD79a (82747-6-RR) by Proteintech is a Recombinant antibody targeting CD79a in WB, ELISA applications with reactivity to human samples
82747-6-RR targets CD79a in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: Daudi cells, Raji cells, Ramos cells
Recommended dilution
Western Blot (WB): WB : 1:5000-1:50000
Background Information
CD79a, also named as B-cell antigen receptor complex-associated protein alpha chain or MB-1 membrane glycoprotein, is a 226 amino acid protein, which contains one ITAM domain and one Ig-like C2-type (immunoglobulin-like) domain. CD79A is expressed in B cells and localizes in the cell membrane. CD79A is required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. CD79A is also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells.
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Ag17924 Product name: Recombinant human CD79A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 33-144 aa of BC113733 Sequence: LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRI Predict reactive species
Full Name: CD79a molecule, immunoglobulin-associated alpha
Calculated Molecular Weight: 226 aa, 25 kDa
Observed Molecular Weight: 38-45 kDa
GenBank Accession Number: BC113733
Gene Symbol: CD79A
Gene ID (NCBI): 973
RRID: AB_3670545
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: P11912
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924