Proteintech, 82760-2-RR, RHOA Recombinant monoclonal antibody

Size: 20ul / 100ul The RHOA (82760-2-RR) by Proteintech is a Recombinant antibody targeting RHOA in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 82760-2-RR targets RHOA in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HUVEC cells, HEK-293 cells, HeLa cells, HL-60 cells, NIH/3T3 cells, mouse brain tissue, rat brain tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information RhoA is a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. Overexpression of RhoA is associated with tumor cell proliferation and metastasis. RhoA signalling is critical to many cellular processes including migration, mechanotransduction, and is often disrupted in carcinogenesis. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1141 Product name: Recombinant human RHOA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-193 aa of BC005976 Sequence: MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL Predict reactive species Full Name: ras homolog gene family, member A Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC005976 Gene Symbol: RHOA Gene ID (NCBI): 387 RRID: AB_3670546 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P61586 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.