Iright
BRAND / VENDOR: Proteintech

Proteintech, 82780-6-RR, Beta Arrestin 2 Recombinant monoclonal antibody

CATALOG NUMBER: 82780-6-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The Beta Arrestin 2 (82780-6-RR) by Proteintech is a Recombinant antibody targeting Beta Arrestin 2 in WB, ELISA applications with reactivity to human, mouse, rat samples 82780-6-RR targets Beta Arrestin 2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: RAW 264.7 cells, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Beta Arrestin 2 is a member of arrestin/beta-arrestin protein family, which are expressed at high levels in the central nervous system (CNS) and play a critical role in the regulation of G-protein coupled receptors (GPCRs) including MOR. Beta Arrestin 2 is an adaptor protein that is important for the regulation of receptors belonging to both dopaminergic and opioid systems. Besides the brain, a cDNA for arrestin beta 2 was isolated from thyroid gland, and thus it may also be involved in hormone-specific desensitization of TSH receptors. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0227 Product name: Recombinant human Beta Arrestin 2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 163-409 aa of BC007427 Sequence: NSVRLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYADICLFSTAQYKCPVAQLEQDDQVSPSSTFCKVYTITPLLSDNREKRGLALDGKLKHEDTNLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIPLPRPQSAAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC Predict reactive species Full Name: arrestin, beta 2 Calculated Molecular Weight: 46 kDa Observed Molecular Weight: 47-50 kDa GenBank Accession Number: BC007427 Gene Symbol: Beta Arrestin 2 Gene ID (NCBI): 409 RRID: AB_3670548 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P32121 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924