Proteintech, 82802-10-RR, CISD2 Recombinant monoclonal antibody

Size: 20ul / 100ul The CISD2 (82802-10-RR) by Proteintech is a Recombinant antibody targeting CISD2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 82802-10-RR targets CISD2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, HuH-7 cells, L02 cells, K-562 cells Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CISD2 gene encodes a 15 kDa CDGSH iron-sulfur domain-containing protein 2, which is also named Miner1 or NAF-1, this protein was reported on endoplasmic reticulum membrane or mitochondrion outer membrane. Defects in CISD2 are the cause of Wolfram syndrome type 2 (WFS2), a rare disorder characterized by juvenile-onset insulin-dependent diabetes mellitus with optic atrophy. CISD2 regulates autophagy program by interacting BCL2, contributing to antagonize BECN1-mediated cellular autophagy at the endoplasmic reticulum. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag4172 Product name: Recombinant human CISD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 61-135 aa of BC032300 Sequence: PKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV Predict reactive species Full Name: CDGSH iron sulfur domain 2 Calculated Molecular Weight: 135 aa, 15 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC032300 Gene Symbol: CISD2 Gene ID (NCBI): 493856 RRID: AB_3670556 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8N5K1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.