Iright
BRAND / VENDOR: Proteintech

Proteintech, 82864-7-RR, VEGFA Recombinant monoclonal antibody

CATALOG NUMBER: 82864-7-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The VEGFA (82864-7-RR) by Proteintech is a Recombinant antibody targeting VEGFA in IHC, IF/ICC, ELISA applications with reactivity to mouse samples 82864-7-RR targets VEGFA in IHC, IF/ICC, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive IHC detected in: mouse lung tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: NIH/3T3 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information Vegfa is a member of the PDGF/VEGF growth factor family. It is a mitogen that specifically acts on endothelial cells and has various effects, including mediating increased vascular permeability, inducing angiogenesis, vasculogenesis, endothelial cell growth, promoting cell migration, and inhibiting apoptosis.It binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. It may play a role in increasing vascular permeability during lactation, when increased transport of molecules from the blood is required for efficient milk protein synthesis. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg32035 Product name: recombinant mouse Vegfa protein Source: mammalian cells -derived, pHZ-KIsec Tag: Myc & 6*His Domain: 27-214 aa of NM_001287056 Sequence: APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKKSVRGKGKGQKRKRKKSRFKSWSVHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR Predict reactive species Full Name: vascular endothelial growth factor A GenBank Accession Number: NM_001287056 Gene Symbol: Vegfa Gene ID (NCBI): 22339 RRID: AB_3670586 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q00731 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924