Iright
BRAND / VENDOR: Proteintech

Proteintech, 82866-16-RR, SFTPB Recombinant monoclonal antibody

CATALOG NUMBER: 82866-16-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The SFTPB (82866-16-RR) by Proteintech is a Recombinant antibody targeting SFTPB in WB, ELISA applications with reactivity to Human, mouse samples 82866-16-RR targets SFTPB in WB, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: mouse lung tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Specification Tested Reactivity: Human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag23605 Product name: Recombinant human SFTPB protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-381 aa of BC032785 Sequence: MAESHLLQWLLLLLPTLCGPGTAAWTTSSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVGADDLCQECEDIVHILNKMAKEAIFQDTMRKFLEQECNVLPLKLLMPQCNQVLDDYFPLVIDYFQNQTDSNGICMHLGLCKSRQPEPEQEPGMSDPLPKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSMDDSAGPRSPTGEWLPRDSECHLCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREKCKQFVEQHTPQLLTLVPRGWDAHTTCQALGVCGTMSSPLQCIHSPDL Predict reactive species Full Name: surfactant protein B Calculated Molecular Weight: 381 aa, 42 kDa Observed Molecular Weight: 43 kDa GenBank Accession Number: BC032785 Gene Symbol: SFTPB Gene ID (NCBI): 6439 RRID: AB_3670588 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P07988 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924