Proteintech, 82875-1-RR, SHPK Recombinant monoclonal antibody

Size: 20ul / 100ul The SHPK (82875-1-RR) by Proteintech is a Recombinant antibody targeting SHPK in IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 82875-1-RR targets SHPK in IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: Human Hepatocellular cancerNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Positive FC (Intra) detected in: U-2 OS Recommended dilution Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information SHPK, also named CARKL, is a carbohydrate kinase involved in the phosphorylation of sugars as they enter a cell, inhibiting return across the cell membrane (PubMed: 10673275). SHPK is a sedoheptulose kinase of the pentose phosphate pathway. It acts as a modulator of macrophage activation through control of glucose metabolism (PMID: 22682222). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag33893 Product name: Recombinant human SHPK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 65-253 aa of BC020543 Sequence: ILQALHECLAALPRPQLRSVVGIGVSGQMHGVVFWKTGQGCEWTEGGITPVFEPRAVSHLVTWQDGRCSSEFLASLPQPKSHLSVATGFGCATIFWLLKYRPEFLKSYDAAGTIHDYVVAMLCGLPRPLMSDQNAASWGYFNTQSQSWNVETLRSSGFPVHLLPDIAEPGSVAGRTSHMWFEIPKGTQV Predict reactive species Full Name: sedoheptulokinase Calculated Molecular Weight: 478 aa, 52 kDa GenBank Accession Number: BC020543 Gene Symbol: SHPK Gene ID (NCBI): 23729 RRID: AB_3670594 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UHJ6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.