Proteintech, 82903-1-RR, KIF15 Recombinant monoclonal antibody

Size: 20ul / 100ul The KIF15 (82903-1-RR) by Proteintech is a Recombinant antibody targeting KIF15 in WB, IHC, ELISA applications with reactivity to human samples 82903-1-RR targets KIF15 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells, K-562 cells Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information KIF15, also named as KLP2 and KNSL7, belongs to the kinesin-like protein family and KLP2 subfamily. It is a plus-end directed kinesin-like motor enzyme which involved in mitotic spindle assembly. Several isoforms of KIF15 exist due to the alternative splicing, with molecular weight between 130-160 kDa. Sometimes higher molecular weight around 200 kDa can also be observed, which may be a modified variant of KIF15. (14618103) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag33897 Product name: Recombinant human KIF15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 950-1050 aa of NM_020242 Sequence: EQQMAKVQKLEESLLATEKVISSLEKSRDSDKKVVADLMNQIQELRTSVCEKTETIDTLKQELKDINCKYNSALVDREESRVLIKKQEVDILDLKETLRLR Predict reactive species Full Name: kinesin family member 15 Calculated Molecular Weight: 160 kDa Observed Molecular Weight: 160 kDa GenBank Accession Number: NM_020242 Gene Symbol: KIF15 Gene ID (NCBI): 56992 RRID: AB_3670632 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NS87 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.