Iright
BRAND / VENDOR: Proteintech

Proteintech, 82920-2-RR, GSDMA Recombinant monoclonal antibody

CATALOG NUMBER: 82920-2-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The GSDMA (82920-2-RR) by Proteintech is a Recombinant antibody targeting GSDMA in WB, IF/ICC, ELISA applications with reactivity to human samples 82920-2-RR targets GSDMA in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Daudi cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Gasdermins, a family of five pore-forming proteins (GSDMA-GSDME) in humans expressed predominantly in the skin, mucosa and immune sentinel cells, are key executioners of inflammatory cell death (pyroptosis), which recruits immune cells to infection sites and promotes protective immunity. GSDMA was predicted to enable phosphatidylinositol-4,5-bisphosphate binding activity, phosphatidylinositol-4-phosphate binding activity, and phosphatidylserine binding activity. Involved in apoptotic process. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag24407 Product name: Recombinant human GSDMA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-146 aa of BC109197 Sequence: MTMFENVTRALARQLNPRGDLTPLDSLIDFKRFHPFCLVLRKRKSTLFWGARYVRTDYTLLDVLEPGSSPSDPTDTGNFGFKNMLDTRVEGDVDVPKTVKVKGTAGLSQNSTLEVQTLSVAPKALETLQERKLAADHPFLKEMQDQ Predict reactive species Full Name: gasdermin A Calculated Molecular Weight: 445 aa, 49 kDa Observed Molecular Weight: 49 kDa GenBank Accession Number: BC109197 Gene Symbol: GSDMA Gene ID (NCBI): 284110 RRID: AB_3670656 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q96QA5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924