Iright
BRAND / VENDOR: Proteintech

Proteintech, 82928-1-RR, BMPR1A Recombinant monoclonal antibody

CATALOG NUMBER: 82928-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The BMPR1A (82928-1-RR) by Proteintech is a Recombinant antibody targeting BMPR1A in WB, FC (Intra), IP, ELISA applications with reactivity to human, mouse samples 82928-1-RR targets BMPR1A in WB, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, U2OS cells, HEK-293 cells, mouse heart tissue Positive IP detected in: HEK-293 cells Positive FC (Intra) detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information BMPR1A (Bone morphogenetic protein receptor type-1A) is also named as ACVRLK3, ALK3 and SKR5. BMPR1A is an essential receptor for BMP signaling (PMID: 26279380). BMPR1A is necessary for chondrogenesis and osteogenesis (PMID: 32764110). BMPR1A is a cell surface marker of human SuSCs (PMID: 33658353). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag3410 Product name: Recombinant human BMPR1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 174-427 aa of BC028383 Sequence: FCYKHYCKSISSRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQVGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAHRDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNKNHFQPYIM Predict reactive species Full Name: bone morphogenetic protein receptor, type IA Calculated Molecular Weight: 532 aa, 60 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC028383 Gene Symbol: BMPR1A Gene ID (NCBI): 657 RRID: AB_3670667 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P36894 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924