Proteintech, 82933-1-RR, CUX2 Recombinant monoclonal antibody

Size: 20ul / 100ul The CUX2 (82933-1-RR) by Proteintech is a Recombinant antibody targeting CUX2 in WB, IF/ICC, ELISA applications with reactivity to human samples 82933-1-RR targets CUX2 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, SH-SY5Y cells, HepG2 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:150-1:600 Background Information Cut like homeobox 2 (CUX2) also named as, CDP2 or CUTL2, is a 1486 amino acid protein, which contains one homeobox DNA-binding domain and three CUT DNA-binding domains. CUX2 localizes in the nucleus and belongs to the CUT homeobox family. CUX2 may as a transcription factor be involved in neural specification. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag18809 Product name: Recombinant human CUX2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 110-433 aa of BC151245 Sequence: RSLDDRLQPPSFDPSGQPRRDLHTSWKRNPELLSPKEQREGTSPAGPTLTEGSRLPGIPGKALLTETLLQRNEAEKQKGLQEVQITLAARLGEAEEKIKVLHSALKATQAELLELRRKYDEEAASKADEVGLIMTNLEKANQRAEAAQREVESLREQLASVNSSIRLACCSPQGPSGDKVNFTLCSGPRLEAALASKDREILRLLKDVQHLQSSLQELEEASANQIADLERQLTAKSEAIEKLEEKLQAQSDYEEIKTELSILKAMKLASSTCSLPQGMAKPEDSLLIAKEAFFPTQKFLLEKPSLLASPEEDPSEDDSIKDSL Predict reactive species Full Name: cut-like homeobox 2 Calculated Molecular Weight: 1486 aa, 162 kDa Observed Molecular Weight: 162 kDa GenBank Accession Number: BC151245 Gene Symbol: CUX2 Gene ID (NCBI): 23316 RRID: AB_3670675 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O14529 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.