Iright
BRAND / VENDOR: Proteintech

Proteintech, 82935-1-RR, PAK7 Recombinant monoclonal antibody

CATALOG NUMBER: 82935-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The PAK7 (82935-1-RR) by Proteintech is a Recombinant antibody targeting PAK7 in WB, FC (Intra), ELISA applications with reactivity to human samples 82935-1-RR targets PAK7 in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, SH-SY5Y cells Positive FC (Intra) detected in: K-562 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information PAK7, also known as PAK5, is a newly found but scarcely researched type II PAKs (PAK4, 5, 6). PAK7 was originally found in the brain, which promotes filopodia formation in nerve cells. Recently, studies have found that the expression level of PAK7 significantly increased in colorectal cancer, ovarian cancer, gastric cancer, neuroglioma, hepatocellular carcinoma, pancreatic cancer, osteosarcoma, and breast cancer. PAK7 plays an important role in tumorigenesis, invasion, and metastasis, mainly related to its mechanism of regulating cytoskeleton, inhibiting apoptosis, and promoting proliferation. The calculated molecular weight of PAK7 is 80 kDa (PMID: 29805709, PMID: 34165002). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag29190 Product name: Recombinant human PAK7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 180-360 aa of BC024179 Sequence: AYYSEVKPLKSDFARFSADYHSHLDSLSKPSEYSDLKWEYQRASSSSPLDYSFQFTPSRTAGTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQTSPQPTMRQRSRSGSGLQEPMMPFGASAFKTHPQGHSYNSYTYPRLSEPTMCIPKVDYDRAQMVLSPPLSGSDTYPRGPAKLPQS Predict reactive species Full Name: p21 protein (Cdc42/Rac)-activated kinase 7 Calculated Molecular Weight: 719 aa, 81 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC024179 Gene Symbol: PAK7 Gene ID (NCBI): 57144 RRID: AB_3670677 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9P286 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924