Iright
BRAND / VENDOR: Proteintech

Proteintech, 82952-2-RR, CPO Recombinant monoclonal antibody

CATALOG NUMBER: 82952-2-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The CPO (82952-2-RR) by Proteintech is a Recombinant antibody targeting CPO in WB, FC (Intra), ELISA applications with reactivity to human samples 82952-2-RR targets CPO in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag24059 Product name: Recombinant human CPO protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-101 aa of BC112078 Sequence: YDRSLAQHRQEIVDKSVSPWSLETYSYNIYHPMGEIYEWMREISEKYKEVVTQHFLGVTYETHPIYYLKISQPSGNPKKII Predict reactive species Full Name: carboxypeptidase O Calculated Molecular Weight: 374 aa, 43 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC112078 Gene Symbol: CPO Gene ID (NCBI): 130749 RRID: AB_3670695 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q8IVL8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924