Proteintech, 82963-1-RR, NAGS Recombinant monoclonal antibody

Size: 20ul / 100ul The NAGS (82963-1-RR) by Proteintech is a Recombinant antibody targeting NAGS in WB, ELISA applications with reactivity to Human, mouse, rat samples 82963-1-RR targets NAGS in WB, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, mouse liver tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information N-acetylglutamate synthase, also known as NAGS, is a mitochondrial enzyme that catalyzes the formation of N-acetylglutamate (NAG) from glutamate and acetyl coenzyme-A. NAGS is the key enzyme for regulating the hepatic urea cycle and is also highly expressed in the kidney and gut. Deficiency of NAGS leads to hyperammonemia due to decreased activity of CPSI deprived of its cofactor NAG(PMID:12459178,12754705). Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag16073 Product name: Recombinant human NAGS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-368 aa of BC111713 Sequence: MDMKPLVVLGLPAPTAPSGCLSFWEAKAQLAKSCKVLVDALRHNAAAAVPFFGGGSVLRAAEPAPHASYGGIVSVETDLLQWCLESGSIPILCPIGETAARRSVLLDSLEVTASLAKALRPTKIIFLNNTGGLRDSSHKVLSNVNLPADLDLVCNAEWVSTKERQQMRLIVDVLSRLPHHSSAVITAASTLLTELFSNKGSGTLFKNAERMLRVRSLDKLDQGRLVDLVNASFGKKLRDDYLASLRPRLHSIYVSEGYNAAAILTMEPVLGGTPYLDKFVVSSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNPINPWYFKHSDGSFSNKQWIFFWFGLADIRDSYELVNHAKGLPDSFHKPASDPGS Predict reactive species Full Name: N-acetylglutamate synthase Calculated Molecular Weight: 534 aa, 58 kDa Observed Molecular Weight: 58 kDa GenBank Accession Number: BC111713 Gene Symbol: NAGS Gene ID (NCBI): 162417 RRID: AB_3670709 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8N159 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.