Proteintech, 82979-6-RR, ARID1B Recombinant monoclonal antibody

Size: 20ul / 100ul The ARID1B (82979-6-RR) by Proteintech is a Recombinant antibody targeting ARID1B in IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 82979-6-RR targets ARID1B in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: SH-SY5Y cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag30643 Product name: Recombinant human ARID1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1370-1508 aa of NM_017519 Sequence: PAKRHEGDMYNMQYSSQQQEMYNQYGGSYSGPDRRPIQGQYPYPYSRERMQGPGQIQTHGIPPQMMGGPLQSSSSEGPQQNMWAARNDMPYPYQNRQGPGGPTQAPPYPGMNRTDDMMVPDQRINHESQWPSHVSQRQP Predict reactive species Full Name: AT rich interactive domain 1B (SWI1-like) Calculated Molecular Weight: 236 kDa GenBank Accession Number: NM_017519 Gene Symbol: ARID1B Gene ID (NCBI): 57492 RRID: AB_3670728 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8NFD5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.