Proteintech, 82998-4-RR, CCDC23 Recombinant monoclonal antibody

Size: 20ul / 100ul The CCDC23 (82998-4-RR) by Proteintech is a Recombinant antibody targeting CCDC23 in IF/ICC, ELISA applications with reactivity to Human samples 82998-4-RR targets CCDC23 in IF/ICC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive IF/ICC detected in: U2OS cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CCDC23 also known as SVBP is a small vasohibin-binding protein of 66 amino acids, and functions as a chaperone of VASH1 in vascular endothelial cells(PMID: 20736312). SVBP enhances the tyrosine carboxypeptidase activity of VASH1 and VASH2, thereby promoting the removal of the C-terminal tyrosine residue of alpha-tubulin(PMID: 29146869, 31171830). Mutations in SVBP cause Neurodevelopmental disorders with ataxia, hypotonia, and microcephaly (NEDAHM)(PMID: 30607023, 31363758). Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag33650 Product name: Recombinant human CCDC23 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-66 aa of BC029427 Sequence: MDPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQMQPPGE Predict reactive species Full Name: coiled-coil domain containing 23 GenBank Accession Number: BC029427 Gene Symbol: CCDC23 Gene ID (NCBI): 374969 RRID: AB_3670745 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8N300 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.