Proteintech, 83020-2-RR, FDFT1 Recombinant monoclonal antibody

Size: 20ul / 100ul The FDFT1 (83020-2-RR) by Proteintech is a Recombinant antibody targeting FDFT1 in IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83020-2-RR targets FDFT1 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: U2OS cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:100-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information SQS (Squalene synthase), also known as Farnesyl-diphosphate farnesyltransferase 1 (FDFT1) is a gene that encodes the membrane-associated enzyme squalene synthase, which is the first specific enzyme in cholesterol biosynthesis. FDFT1 is highly expressed in liver, lung, prostate, breast, ovary, bladder, cervix, thyroid, and esophageal cancers, while in colorectal, colon, testicular, uterine, pancreas, and kidney tumors, its expression is downregulated (PMID: 35093030). FDFT1 is a key downstream target of the fasting response and may be involved in CRC cell glucose metabolism (PMID: 32313017). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag3743 Product name: Recombinant human SQS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-358 aa of BC029641 Sequence: MEFVKCLGHPEEFYNLVRFRIGGKRKVMPKMDQDSLSSSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICRRMGIGMAEFLDKHVTSEQEWDKYCHYVAGLVGIGLSRLFSASEFEDPLVGEDTERANSMGLFLQKTNIIRDYLEDQQGGREFWPQEVWSRYVKKLGDFAKPENIDLAVQCLNELITNALHHIPDVITYLSRLRNQSVFNFCAIPQVMAIATLAACYNNQQVFKGAVKIRKGQAVTLMMDATNMPAVKAIIYQYMEEIYHRIPDSDPSSSK Predict reactive species Full Name: farnesyl-diphosphate farnesyltransferase 1 Calculated Molecular Weight: 417 aa, 48 kDa GenBank Accession Number: BC029641 Gene Symbol: FDFT1 Gene ID (NCBI): 2222 RRID: AB_3670762 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P37268 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.