Iright
BRAND / VENDOR: Proteintech

Proteintech, 83024-1-RR, PTPN18 Recombinant monoclonal antibody

CATALOG NUMBER: 83024-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The PTPN18 (83024-1-RR) by Proteintech is a Recombinant antibody targeting PTPN18 in WB, FC (Intra), ELISA applications with reactivity to human samples 83024-1-RR targets PTPN18 in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells, MCF-7 cells, T-47D cells Positive FC (Intra) detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information PTPN18 (also called PTP-HSCF or BDP1), a member of the protein tyrosine phosphatase superfamily, has been reported to be a tumor suppressor in breast cancer by dephosphorylating HER2 and suppressing cell proliferation and invasion. In addition to the well-established role of PTPN18 in breast cancer, our previous study found that PTPN18 and CSK cooperate to inhibit the events triggered by SRC kinases. (PMID: 35982039) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34048 Product name: Recombinant human PTPN18 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 250-351 aa of BC052800 Sequence: VQKRGAPAGAGSGTQTGTGTGARSAEEAPLYSKVTPRAQRPGAHAEDARGTLPGRVPADQSPAGSGAYEDVAGGAQTGGLGFNLRIGRPKGPRDPPAEWTRV Predict reactive species Full Name: protein tyrosine phosphatase, non-receptor type 18 (brain-derived) Calculated Molecular Weight: 460 aa, 50 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC052800 Gene Symbol: PTPN18 Gene ID (NCBI): 26469 RRID: AB_3670764 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q99952 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924