Proteintech, 83036-3-RR, SLC29A3 Recombinant monoclonal antibody

Size: 20ul / 100ul The SLC29A3 (83036-3-RR) by Proteintech is a Recombinant antibody targeting SLC29A3 in WB, ELISA applications with reactivity to human samples 83036-3-RR targets SLC29A3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, LNCaP cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag18563 Product name: Recombinant human SLC29A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-60 aa of BC120996 Sequence: MAVVSEDDFQHSSNSTYRTTSSSLRADQEALLEKLLDRPPPGLQRPEDRFCGTYIIFFSL Predict reactive species Full Name: solute carrier family 29 (nucleoside transporters), member 3 Calculated Molecular Weight: 475 aa, 52 kDa Observed Molecular Weight: 51 kDa, 60 kDa GenBank Accession Number: BC120996 Gene Symbol: SLC29A3 Gene ID (NCBI): 55315 RRID: AB_3670768 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9BZD2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.