Iright
BRAND / VENDOR: Proteintech

Proteintech, 83055-6-RR, CD14 Recombinant monoclonal antibody

CATALOG NUMBER: 83055-6-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The CD14 (83055-6-RR) by Proteintech is a Recombinant antibody targeting CD14 in WB, ELISA applications with reactivity to human samples 83055-6-RR targets CD14 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HL-60 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information CD14 is a 50-55 kDa glycosylphosphatidylinositol-anchored glycoprotein preferentially expressed on monocytes and macrophages, and at lower levels on granulocytes (PMID: 3385210; 2462937; 7685797). CD14 can also exist as a soluble protein. CD14 acts as a co-receptor for bacterial liposaccharides (LPS) (PMID: 1698311). It plays a major role in the inflammatory response of monocytes to LPS. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0498 Product name: Recombinant human CD14 protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 20-344 aa of BC010507 Sequence: TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSM Predict reactive species Full Name: CD14 molecule Calculated Molecular Weight: 375 aa, 40 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC010507 Gene Symbol: CD14 Gene ID (NCBI): 929 ENSEMBL Gene ID: ENSG00000170458 RRID: AB_3670781 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P08571 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924