Iright
BRAND / VENDOR: Proteintech

Proteintech, 83059-6-RR, SOX2 Recombinant monoclonal antibody

CATALOG NUMBER: 83059-6-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The SOX2 (83059-6-RR) by Proteintech is a Recombinant antibody targeting SOX2 in WB, ELISA applications with reactivity to human, mouse, rat samples 83059-6-RR targets SOX2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, U-251 cells, rat brain tissue, C6 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Sox2, also known as SRY (sex determining region Y)-box 2, is a transcription factor essential for maintaining self-renewal of undifferentiated ES cells and is one of the key transcription factors used to reprogram mouse and human fibroblasts to a pluripotent state. Sox2 expressed in undifferentiated pluripotent stem cells and germ cells during development. Affinity purified rabbit anti-Sox2 antibody can be used to demonstrate pluripotency of ES and iPS cells. This antibody is a rabbit polyclonal antibody raised against an internal region of human SOX2. a rare undiferentiated cell population that is intermingled with the Bergmann glia of the adult murine cerebellar cortex, expresses the stem cell markers Sox2 and Nestin, and lacks markers of glial or neuronal diferentiation. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0612 Product name: Recombinant human SOX2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 59-118 aa of BC013923 Sequence: MAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKT Predict reactive species Full Name: SRY (sex determining region Y)-box 2 Calculated Molecular Weight: 34 kDa Observed Molecular Weight: 34-43 kDa GenBank Accession Number: BC013923 Gene Symbol: SOX2 Gene ID (NCBI): 6657 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P48431 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924