Proteintech, 83081-2-RR, STK39 Recombinant monoclonal antibody

Size: 20ul / 100ul The STK39 (83081-2-RR) by Proteintech is a Recombinant antibody targeting STK39 in WB, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 83081-2-RR targets STK39 in WB, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, HepG2 cells, MCF-7 cells, SH-SY5Y cells, HEK-293T cells, rat brain tissue Positive IF-P detected in: mouse brain tissue Positive IF/ICC detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information STK39 (Serine/Threonine Kinase 39) is a proline- and alanine-rich Ste20-related kinase (also named as SPAK), which is composed of a short N-terminal proline and alanine repeats (PAPA box), a kinase catalytic domain and a C-terminal regulatory domain (PMID: 16382158). In mammalians, STK39 plays an important role in ion homeostasis by regulating the cation chloride cotransporters' activities, which is crucial for the modulation of renal salt transport and blood pressure (PMID: 33500714). Notably, STK39 is also implicated in the regulation of tumor cell proliferation, migration, and invasion in multiple cancers, including osteosarcoma and cervical cancer (PMID: 34335956). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34503 Product name: Recombinant human STK39 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 396-455 aa of BC166614 Sequence: GKAAFSQEKSRRVKEENPEIAVSASTIPEQIQSLSVHDSQGPPNANEDYREASSCAVNLV Predict reactive species Full Name: serine threonine kinase 39 (STE20/SPS1 homolog, yeast) Calculated Molecular Weight: 59 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC166614 Gene Symbol: STK39 Gene ID (NCBI): 27347 RRID: AB_3670797 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UEW8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.