Iright
BRAND / VENDOR: Proteintech

Proteintech, 83087-1-RR, GDNF Recombinant monoclonal antibody

CATALOG NUMBER: 83087-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The GDNF (83087-1-RR) by Proteintech is a Recombinant antibody targeting GDNF in IHC, IF/ICC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse samples 83087-1-RR targets GDNF in IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Positive IF/ICC detected in: SH-SY5Y cells Positive FC (Intra) detected in: SH-SY5Y cells, U-251 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:125-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Glial-derived neurotrophic factor (GDNF) is a member of the transforming growth factor (TGF)-α family and exhibits potent neuroprotective activity. GDNF is a potent promoter of neuronal survival in the CNS and peripheral nervous system (PNS). It has a relatively high speciicity for dopaminergic neurons and thus become an efective treatment for Parkinson's diseases (PD), with clinical trials currently in progress. Protein dimers of GDNF have a reported molecular weight of 32-40 kDa(PMID: 17982417, PMID: 23251488, PMID: 11429269). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag24068 Product name: Recombinant human GDNF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 78-211 aa of BC069369 Sequence: SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI Predict reactive species Full Name: glial cell derived neurotrophic factor Calculated Molecular Weight: 211 aa, 24 kDa Observed Molecular Weight: 32-40 kDa GenBank Accession Number: BC069369 Gene Symbol: GDNF Gene ID (NCBI): 2668 RRID: AB_3670802 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P39905 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924