Iright
BRAND / VENDOR: Proteintech

Proteintech, 83103-1-RR, HLA-DRB4 Recombinant monoclonal antibody

CATALOG NUMBER: 83103-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The HLA-DRB4 (83103-1-RR) by Proteintech is a Recombinant antibody targeting HLA-DRB4 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, pig samples 83103-1-RR targets HLA-DRB4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: Raji cells, Ramos cells, Daudi cells, pig spleen tissue Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Raji cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, pig Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag8492 Product name: Recombinant human HLA-DRB4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-266 aa of BC005312 Sequence: MVCLKLPGGSCMAALTVTLTVLSSPLALAGDTQPRFLEQAKCECHFLNGTERVWNLIRYIYNQEEYARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSMMSPLTVQWSARSESAQSKMLSGVGGFVLGLLFLGTGLFIYFRNQKGHSGLQPTGLLS Predict reactive species Full Name: major histocompatibility complex, class II, DR beta 4 Calculated Molecular Weight: 266 aa, 30 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC005312 Gene Symbol: HLA-DRB4 Gene ID (NCBI): 3126 RRID: AB_3670816 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P13762 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924