Iright
BRAND / VENDOR: Proteintech

Proteintech, 83107-1-RR, DTL Recombinant monoclonal antibody

CATALOG NUMBER: 83107-1-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The DTL (83107-1-RR) by Proteintech is a Recombinant antibody targeting DTL in IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83107-1-RR targets DTL in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information CDT2, also named as L2DTL or RAMP, is one of the substrate receptors of the Cullin Ring Ubiquitin Ligase 4 that targets for ubiquitin mediated degradation a number of substrates, such as CDT1, p21 and CHK1, involved in the regulation of cell cycle and survival. CDT2 overexpression was reported in breast (PMID: 18542055), gastric (PMID: 19672268) and ovarian carcinomas (PMID: 23995842) and rhabdomyosarcomas (PMID: 19235922) and associated with the aggressiveness of hepatocellular carcinomas (PMID: 17106265). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag33391 Product name: Recombinant human DTL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-240 aa of BC033540 Sequence: MLFNSVLRQPQLGVLRNGWSSQYPLQSLLTGYQCSGNDEHTSYGETGVPVPPFGCTFSSAPNMEHVLAVANEEGFVRLYNTESQSFRKKCFKEWMAHWNAVFDLAWVPGELKLVTAAGDQTAKFWDVKAGELIGTCKGHQCSLKSVAFSKFEKAVFCTGGRDGNIMVWDTRCNKKDGFYRQVNQISGAHNTSDKQTPSKPKKKQNSKGLAPSVDFQQSVTVVLFQDENTLVSAGAVDGII Predict reactive species Full Name: denticleless homolog (Drosophila) Calculated Molecular Weight: 730 aa, 79 kDa GenBank Accession Number: BC033540 Gene Symbol: DTL Gene ID (NCBI): 51514 RRID: AB_3670819 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NZJ0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924