Iright
BRAND / VENDOR: Proteintech

Proteintech, 83151-5-RR, TIMP1 Recombinant monoclonal antibody

CATALOG NUMBER: 83151-5-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The TIMP1 (83151-5-RR) by Proteintech is a Recombinant antibody targeting TIMP1 in IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83151-5-RR targets TIMP1 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HT-29 cells, MDA-MB-231 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information TIMP1 is a member of the family of matrix metalloproteinase inhibitors, which contains four members (TIMP1, TIMP2, TIMP3, and TIMP4). Tissue inhibitors of metalloproteinases (TIMPs) are multifaceted molecules that exhibit properties beyond their classical proteinase inhibitory function. TIMP1 has several MMP-independent functions such as modulation of angiogenesis, promotion of cell proliferation, and inhibition of apoptosis. TIMP1 plays important role in cell cycle regulation and cancer progression. Recently, clinical studies have shown that the aberrant expression of TIMP1 is associated with an unfavorable prognosis in a series of tumors, such as gastric cancer, papillary thyroid carcinoma, cutaneous melanoma and breast cancer. In pregnancy, TIMP1 plays a regulatory role in the process of implantation, particularly the cytotrophoblast invasion of the uterine endometrium. In pregnancy, TIMP1 plays a regulatory role in the process of implantation, particularly the cytotrophoblast invasion of the uterine endometrium. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0638 Product name: Recombinant human TIMP1 protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 24-207 aa of BC000866 Sequence: CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA Predict reactive species Full Name: TIMP metallopeptidase inhibitor 1 Calculated Molecular Weight: 23 kDa GenBank Accession Number: BC000866 Gene Symbol: TIMP1 Gene ID (NCBI): 7076 RRID: AB_3670846 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P01033 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924