Proteintech, 83156-3-RR, FMO1 Recombinant monoclonal antibody

Size: 20ul / 100ul The FMO1 (83156-3-RR) by Proteintech is a Recombinant antibody targeting FMO1 in WB, ELISA applications with reactivity to human, mouse, rat samples 83156-3-RR targets FMO1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human kidney tissue, mouse liver tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Flavin-containing monooxygenase 1 (FMO1) belongs to the FMO family. FMO1 is an enzyme that catalyzes the oxygenation of a series of sulfur-containing and nitrogen-containing substrates, and thus is involved in a series of drugs and xenobiotics metabolism. FMO1 can regulate PPAR-α and mediate metabolic processes. FMO1 is expressed at relatively high levels in human fetal liver and also represents the major FMO enzyme in the adult human and rabbit intestine and kidney (PMID: 11809920, 30757917, 37553313). Human FMO1 has 2 isoforms with the molecular weights of 53 and 60 kDa. The observed molecular weight of FMO1 is 53 kDa, which might be the unmodified form of FMO1 (PMID: 9778310). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34267 Product name: Recombinant human FMO1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 100-430 aa of NM_001282692 Sequence: LLKHIQFKTKVCSVTKCSDSAVSGQWEVVTMHEEKQESAIFDAVMVCTGFLTNPYLPLDSFPGINAFKGQYFHSRQYKHPDIFKDKRVLVIGMGNSGTDIAVEASHLAEKVFLSTTGGGWVISRIFDSGYPWDMVFMTRFQNMLRNSLPTPIVTWLMERKINNWLNHANYGLIPEDRTQLKEFVLNDELPGRIITGKVFIRPSIKEVKENSVIFNNTSKEEPIDIIVFATGYTFAFPFLDESVVKVEDGQASLYKYIFPAHLQKPTLAIIGLIKPLGSMIPTGETQARWAVRVLKGVNKLPPPSVMIEEINARKENKPSWFGLCYCKALQS Predict reactive species Full Name: flavin containing monooxygenase 1 Calculated Molecular Weight: 60 kDa Observed Molecular Weight: 53-60 kDa GenBank Accession Number: NM_001282692 Gene Symbol: FMO1 Gene ID (NCBI): 2326 RRID: AB_3670850 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q01740 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.