Proteintech, 83164-3-RR, COX6B2 Recombinant monoclonal antibody

Size: 20ul / 100ul The COX6B2 (83164-3-RR) by Proteintech is a Recombinant antibody targeting COX6B2 in WB, ELISA applications with reactivity to mouse samples 83164-3-RR targets COX6B2 in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1983 Product name: Recombinant human COX6B2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-88 aa of BC064548 Sequence: MLDVEAQEPPKGKWSTPPFDPRFPSQNQIRNCYQNFLDYHRCLKTRTRRGKSTQPCEYYFRVYHSLCPISWVESWNEQIKNGIFAGKI Predict reactive species Full Name: cytochrome c oxidase subunit VIb polypeptide 2 (testis) Calculated Molecular Weight: 88 aa, 11 kDa Observed Molecular Weight: 11 kDa GenBank Accession Number: BC064548 Gene Symbol: COX6B2 Gene ID (NCBI): 125965 RRID: AB_3670859 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q6YFQ2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.