Proteintech, 83169-5-RR, SMAD4 Recombinant monoclonal antibody

Size: 20ul / 100ul The SMAD4 (83169-5-RR) by Proteintech is a Recombinant antibody targeting SMAD4 in WB, IF/ICC, FC (Intra), ELISA, ChIP-qPCR applications with reactivity to human, mouse samples 83169-5-RR targets SMAD4 in WB, IF/ICC, FC (Intra), ELISA, ChIP-qPCR applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: BxPC-3 cells, HEK-293 cells, NIH/3T3 cells, MCF-7 cells Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HepG2 cells Positive ChIP-qPCR detected in: TGF-β1 (7 ng/ml, 1 h) HaCaT cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension CHIP-QPCR: CHIP-QPCR : 1:10-1:100 Background Information Mammalian homologs of the Drosophila Mad gene include Smad1, Smad2, Smad3, Smad4 (DPC4), Smad5, Smad6, Smad7 and Smad8. Smad1 and Smad5 are effectors of BMP2 and BMP4 function while Smad2 and Smad3 are involved in TGF and activin-mediated growth modulation. Smad4 has been shown to mediate all of the above activities through interaction with various Smad family members. Smad6 and Smad7 regulate the response to activin/ TGF signaling by interfering with TGF-mediated phosphorylation of other Smad family members. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0299 Product name: Recombinant human SMAD4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 13-227 aa of BC002379 Sequence: NDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQTIQHPPSNRASTETYSTPALLAPSESNATSTANFPNIPVASTSQPAS Predict reactive species Full Name: SMAD family member 4 Calculated Molecular Weight: 60 kDa Observed Molecular Weight: 63-70 kDa GenBank Accession Number: BC002379 Gene Symbol: SMAD4 Gene ID (NCBI): 4089 RRID: AB_3670865 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q13485 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.