Iright
BRAND / VENDOR: Proteintech

Proteintech, 83188-2-RR, MMP13 Recombinant monoclonal antibody

CATALOG NUMBER: 83188-2-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The MMP13 (83188-2-RR) by Proteintech is a Recombinant antibody targeting MMP13 in IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83188-2-RR targets MMP13 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: MCF-7 cells Positive FC (Intra) detected in: MCF-7 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information MMP-13(Matrix metalloproteinase-13), cleaves type I collagen and was previously thought to be the rodent analogue of human interstitial MMP-1. MMP-13 is found in hypertrophic and calcifying cartilage of mammalian growth plate. The bands seen with rat MMP-13 are consistent with a 59-kDa latent form and a 43-kDa active form reported for this enzyme, along with a smaller band at approximately 30 kDa(PMID:10771523). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34892 Product name: Recombinant human MMP13 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 100-471 aa of BC074808 Sequence: DVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC Predict reactive species Full Name: matrix metallopeptidase 13 Calculated Molecular Weight: 471 aa, 54 kDa Observed Molecular Weight: 70 kDa, 54 kDa GenBank Accession Number: BC074808 Gene Symbol: MMP13 Gene ID (NCBI): 4322 RRID: AB_3670877 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P45452 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924