Iright
BRAND / VENDOR: Proteintech

Proteintech, 83189-3-RR, SORBS2 Recombinant monoclonal antibody

CATALOG NUMBER: 83189-3-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The SORBS2 (83189-3-RR) by Proteintech is a Recombinant antibody targeting SORBS2 in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83189-3-RR targets SORBS2 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: L02 cells, HuH-7 cells Positive IF/ICC detected in: U2OS cells Positive FC (Intra) detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information SORBS2, also known as ARGBP2, has three C-terminal SH3 domains and an N-terminal sorbin homology (SoHo) domain that interacts with lipid raft proteins. SORBS2 is widely expressed in human tissues and extremely abundant in the heart. In epithelial cells SORBS2 is located in stress fibers and the nucleus; In cardiac muscle cells. SORBS2 is located in the Z-disks of sarcomeres. The subcellular localization suggests that SORBS2 functions as an adapter protein to assemble signaling complexes in stress fibers, and may influence the contractile or elastic properties of cardiac sarcomeres(PMID: 9211900). Alternate splicing results in multiple transcript variants( PMID: 28961272). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag20041 Product name: Recombinant human SORBS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-198 aa of BC011883 Sequence: MSYYQRPFSPSAYSLPASLNSSIVMQHGTSLDSTDTYPQHAQSLDGTTSSSIPLYRSSEEEKRVTVIKAPHYPGIGPVDESGIPTAIRTTVDRPKDWYKTMFKQIHMVHKPDDDTDMYNTPYTYNAGLYNPPYSAQSHPAAKTQTYRPLSKSHSDNSPNAFKDASSPVPPPHVPPPVPPLRPRDRSSTEKHDWDPPDR Predict reactive species Full Name: sorbin and SH3 domain containing 2 Calculated Molecular Weight: 1100 aa, 124 kDa Observed Molecular Weight: 70-75 kDa GenBank Accession Number: BC011883 Gene Symbol: SORBS2 Gene ID (NCBI): 8470 RRID: AB_3670879 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: O94875 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924