Proteintech, 83192-1-RR, SLC22A4 Recombinant monoclonal antibody

Size: 20ul / 100ul The SLC22A4 (83192-1-RR) by Proteintech is a Recombinant antibody targeting SLC22A4 in WB, ELISA applications with reactivity to human, mouse samples 83192-1-RR targets SLC22A4 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue, mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information SLC22A4 (solute carrier family 22 member 4), also known as OCTN1. It is expected to be located in cell membrane and mitochondrion membrane. It is strongly expressed in kidney, trachea, bone marrow and fetal liver and in several human cancer cell lines, but not in adult liver (PMID: 9426230). The protein functions as a Na+-dependent and pH-dependent high affinity microbial symporter of potent food-derived antioxidant ergothioeine (PubMed:15795384), which transports one sodium ion with one ergothioeine molecule. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag3974 Product name: Recombinant human SLC22A4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 32-142 aa of BC028313 Sequence: NGFNGMSVVFLAGTPEHRCRVPDAANLSSAWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTVVTEWNLVCEDNWKV Predict reactive species Full Name: solute carrier family 22 (organic cation/ergothioneine transporter), member 4 Calculated Molecular Weight: 551 aa, 62 kDa Observed Molecular Weight: 62-65 kDa GenBank Accession Number: BC028313 Gene Symbol: SLC22A4 Gene ID (NCBI): 6583 RRID: AB_3670882 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9H015 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.