Iright
BRAND / VENDOR: Proteintech

Proteintech, 83194-5-RR, HIRA Recombinant monoclonal antibody

CATALOG NUMBER: 83194-5-RR
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The HIRA (83194-5-RR) by Proteintech is a Recombinant antibody targeting HIRA in IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 83194-5-RR targets HIRA in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: K-562 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information HIRA protein is encoded by a gene within a region of human chromosome 22q11.2 deleted in most patients with the DiGeorge syndrome, a developmental disorder, and was named for its amino acid sequence homology to two S. cerevisiae proteins, Hir1p and Hir2p. HIRA is critical in a specific chromatin assembly pathway that takes place independently of DNA synthesis (PMID: 12049744). HIRA complex associates with various proteins, such as transcription factors, RNA pol II, Prohibitin (PHB), and replication protein A (RPA) suggests that the targeting of the complex at specific locations may exploit additional structural properties and mechanisms (PMID: 30082790). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34439 Product name: Recombinant human HIRA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 850-1017 aa of NM_003325 Sequence: SLSTWNLVSDKQDSLAQCADFRSSLPSQDAMLCSGPLAIIQGRTSNSGRQAARLFSVPHVVQQETTLAYLENQVAAALTLQSSHEYRHWLLVYARYLVNEGFEYRLREICKDLLGPVHYSTGSQWESTVVGLRKRELLKELLPVIGQNLRFQRLFTECQEQLDILRDK Predict reactive species Full Name: HIR histone cell cycle regulation defective homolog A (S. cerevisiae) Calculated Molecular Weight: 112 kDa GenBank Accession Number: NM_003325 Gene Symbol: HIRA Gene ID (NCBI): 7290 RRID: AB_3670884 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P54198 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924