Proteintech, 83195-5-RR, SLC6A12 Recombinant monoclonal antibody

Size: 20ul / 100ul The SLC6A12 (83195-5-RR) by Proteintech is a Recombinant antibody targeting SLC6A12 in WB, ELISA applications with reactivity to Human samples 83195-5-RR targets SLC6A12 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HepG2 cells, HuH-7 cells, MCF-7 cells, HEK-293T cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag18778 Product name: Recombinant human SLC6A12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 548-614 aa of BC126215 Sequence: VCVPLFVVITLLKTRGPFRKRLRQLITPDSSLPQPKQHPCLDGSAGRNFGPSPTREGLIAGEKETHL Predict reactive species Full Name: solute carrier family 6 (neurotransmitter transporter, betaine/GABA), member 12 Calculated Molecular Weight: 614 aa, 69 kDa Observed Molecular Weight: 69 kDa GenBank Accession Number: BC126215 Gene Symbol: SLC6A12 Gene ID (NCBI): 6539 RRID: AB_3670885 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P48065 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.