Proteintech, 83224-5-RR, PARK2/Parkin Recombinant monoclonal antibody

Size: 20ul / 100ul The PARK2/Parkin (83224-5-RR) by Proteintech is a Recombinant antibody targeting PARK2/Parkin in WB, ELISA applications with reactivity to human, mouse samples 83224-5-RR targets PARK2/Parkin in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293T cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information Parkin, a RING-type E3 ubiquitin-protein ligase, is involved in the ubiquitination pathway and contributes to protection from neurotoxicity induced by unfolded protein stresses. Its ubiquitin-protein ligase activity promotes the degradation of a variety of proteins including itself. Mutations in Parkin are implicated in the pathogenesis of autosomal recessive familial Parkinson's disease. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag5092 Product name: Recombinant human Parkin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 81-387 aa of BC022014 Sequence: NATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVGTGDTVVLRGALGGFRRGVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGYGQRRTK Predict reactive species Full Name: Parkinson disease (autosomal recessive, juvenile) 2, parkin Calculated Molecular Weight: 52 kDa Observed Molecular Weight: 45-55 kDa GenBank Accession Number: BC022014 Gene Symbol: Parkin Gene ID (NCBI): 5071 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O60260 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.